Protein engineering without the guesswork

Design improved variants of your target protein sequence with just a few clicks — and some machine learning.

TRUSTED BY
Target protein sequence

MLCDLKQGEPICVQKERKTPRDSGQQCHACIJKMGGHQ

Stability
Activity
Generate variants

Bring lab data or start fresh

Get started by importing assay data from an ongoing project – or start fresh from just a single starting sequence.

No surprises in the lab

Each generated sequence comes with a predicted performance score. Less exciting for some, more productive for everyone.

Reach objectives in half the time

Cradle learns with every experimental round, giving you better variants each time – and dramatically cutting your time-to-market .

Optimize everything at once

Cradle lets you optimize multiple properties at once. You save time, the models learn faster. It’s a win-win.

Used by industry
leaders and #bioneers

The world’s leading biotech teams are using Cradle to accelerate new and ongoing projects – and to revisit challenging ones.

Multi-property.
No-problem.

Unlike traditional methods, Cradle is engineered to handle multiple properties and optimization tasks in a single round.

Enzymes

Vaccines

Peptides

Antibodies

Activity

Thermostability

Solvent stability

Solubility

Substrate specificity

E-coli expression

MSTASGVEEQVIVNYQDSKNGYKIIKKATLWAFNRGVDWKFYKYLRGKQTYQCDLKQGIGTINRPEPTIDESKGVTVLIKRYLNFNAKPMRYFEKLDEEPGDKTYVTVLKKNGRKVMMFNTGVYEYKYLSVHQTYFRLFVNSHGRSLSGQAYNFGRGVCYNDNFQKGYMNGRNSYENVAHIFCICGNVPEVACCINESMSTASGVEEQVIVNYQDSKNGEPICVQKESWLWEVTGPYRINYPDRKKQVVYYKEMTQHTAKGSFQATSVDRKTPRDSGQQGYPCCPIMKISQDWTDKAIFSENGVYVRNIGTINRKGVTVLIKRYLENZYMESNFNAKPMRYFEKLDEEPGDKTYVFRLFVNSHGRSLSGQAYNFGRGVCYNDNFQKGYMNGRNSYENVAHIFCICGNVPEMSTASGVEEQVIVNYQDSKNGYKIIKKATLWAFNRGVDWKFYKYLRGKQTYQCDLKQGEPICVQKESWLWEVTGPYRINYPDRKKTQATSVDRKTPRDSGQQGYPCCPIMKISQDWTMDDANTIBODIESKAIFSNVYVRNYKIIKKATLWAFNRGVDWKFYKYLRGKQTYQCDLKQGEPICVQKESWLWEVTGPYRINYPDRKKQVVQDWTDKAIFSENGVYVRNIG

Proteins are complicated.
Using Cradle is not.

We've designed Cradle to be as easy as possible to get started with – that means it fits right into your existing workflow.

1

Set up assays and objectives

Getting started is easy, just tell Cradle what you plan to measure and where you want those measurements to go for your project to be successful.

2

Generate sequences

3

Test in lab

4

Import lab results

Private. Secure. Yours.

With Cradle, your sequences and data are kept private and secure while giving you full ownership of all intellectual property.

Private by design

Only you and people you invite can access your sequences and experimental data. Your data is never used to train models for other users.

Safe & Secure

Cradle uses bank-grade level of security to keep your data safe.

Own your IP

You own your IP. Royalties? Nope. With Cradle you pay a flat fee per year for using our tools for your project.

PCCPIMKISQDWTDAATNMODREAKAIFSENGVYVRNYKIIKKATLWAFNRGVDWKFYKYLRGKQTYQCDLKQGEPICVQKESWLWE

QCDLKQGEPICVQKESWLWEVTGPYRINMSTASGVEEQVIVNYQDSKNGYKIIKKATLWAFNRGVDWKFYKYLRGKQTYQCDLKQGIGTINRPSQTIDLSKGVTVLIKRYLNFNAKPMRYFEKLDEEPGDKTYVTVLKKNGRKVMMFNTGVYEYKYLSVHQTYFRLFVNSHGRSLSGQAYNFGRGVCYNDNFQKGYMNGRNSYENVAHIFCICGNVPEMKTYVTVLKKNGRKVMMFNTGVYEYKYLSVHQTYFRLFVNSHGRSLSGQAYNFGRGVCVVQDWTDKAIFSENGVYVRNIGTINRKGVTVYYKEMTQHTAKGSFQATSVDYQCDLKQGEPICVQKESWLWEVTGPYRINMSTASGVEEQVIVNYQDSKNGYKIIKKATLWAFNRGVDWKFYKYLRGKQTYQCDLKQGIGTINRPSQTIDLSKGVTVLIKRYLNFNAKPMRYFEKLDEEPGDKTYVTVLKKNGRKVMMFNNFNAKPMRYFEKLDEEPGDKTYVTVLKKNGRKVMMFNTGVYEYKYL

RNIGTINRKGVTVYYKEMTQHTAKGSFQA

The team

At Cradle we believe biology can theoretically be used to produce almost anything, from therapeutics to chemicals, materials and food. Designing proteins is not easy, but with our tools and machine learning models we are changing that.

Summer offsite

Stef at CogX

Co-working week

Lab day for ML team

Backed by the best

We are funded by leading investors IVP, Index Ventures, and Kindred Capital, as well as long list of world-class advisors and angel investors

IVP

IVP have helped grow breakout like companies Slack, Netflix, Github and many others into enduring market leaders.

Index Ventures

Index helps entrepreneurs turn bold ideas into businesses that have a long-lasting positive impact on the world.

Kindred Capital

Kindred is an early investor in LabGenius, Ori, Eleven Tx, and others.

Emily Leproust

CEO at Twist Biosciences

Steve Crossan

SVP AI at GSK, former Head of Product at Google Deepmind and co-founder of Alphafold project

Adriaan Mol

Founder at Mollie & Messagebird

John Zimmer

CEO & Founder at Lyft

Tim Geistlinger

Chief Scientific Officer at Perfect Day

Mehdi Ghissassi

Director of Product at Google Deepmind

Patrick Hsu

Professor at Berkley & Founder of Arc Institute

Feike Sijbesma

Honorary Chairman and former CEO at Royal DSM

Sylvain Gariel

Founder & COO at DNA Script

Chris Gibson

Co-founder & CEO at Recursion

Tom Glocer

Former CEO of Thomson Reuters and Lead Director at Merck

Built with ❤️ in Amsterdam & Zurich

© 2025 · Cradle is a registered trademark